Protein or peptide name:	sORF2
Chromosome:	VII
Protein or peptide start site:	947477
Protein or peptide end site:	947647
ncRNA start site:	947420
ncRNA end site:	948997
Genome Browser:	NA
Protein or peptide sequence:	MNVRGNQCIMSIRVFLKAGESSLSFAIKWLKRFEATTKKNQYIQNGWPLKDGNKKRK
Protein or peptide length:	57aa
ncRNA type:	ncRNA
ncRNA name:	DIE2
Entrez ID:	853142
Experimental species:	Saccharomyces cerevisiae (yeast)
Experimental techniques:	Western blotting
Experimental sample (cell line and/or tissue):	BY4741;BY4742
Description:	In this study, we further identified this element and observed that overexpression of a small protein (sORF2) of 57 amino acids encoded in this region caused growth inhibition.
Subcellular location:	NA
Function:	sORF2 (designated as OTO1) is an orphan ORF that determines the specificity of this species.
Title of paper:	Small toxic protein encoded on chromosome VII of Saccharomyces cerevisiae
PMID:	25781884
Year of publication:	2015